SCOP 1.75: Domain d3boya1: 3boy A:5-148

Lineage for d3boya1 (3boy A:5-148)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234

4. Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family)

5. Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (1 protein)

6. Protein Hut operon positive regulatory protein HutP [111066] (1 species)
   an RNA-binding antitermination protein

7. Species Bacillus subtilis [TaxId:1423] [111067] (10 PDB entries)
   Uniprot P10943

8. Domain d3boya1: 3boy A:5-148 [155459]
   automatically matched to d1veab_
   complexed with his, mg; mutant

Details for d3boya1

PDB Entry: 3boy, 1.7 Å

PDB Description: crystal structure of the hutp antitermination complex bound to the hut mrna

PDB Compounds: (A:) Hut operon positive regulatory protein

SCOP Domain Sequences for d3boya1:

Sequence; same for both SEQRES and ATOM records:

>d3boya1 d.275.1.1 (A:5-148) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
kerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgvi
qsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavs
lygtigapikglehetfgvginhi

Timeline for d3boya1:

• d3boya1 is new in SCOP 1.75
  
• d3boya1 is called d3boya_ in SCOPe 2.01
  
• d3boya1 appears in the current release, SCOPe 2.08, called d3boya_