Lineage for d3bolb2 (3bol B:1-300)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090074Superfamily c.1.26: Homocysteine S-methyltransferase [82282] (1 family) (S)
  5. 2090075Family c.1.26.1: Homocysteine S-methyltransferase [82283] (3 protein domains)
    Pfam PF02574
  6. 2090087Protein Cobalamin-dependent methionine synthase MetH, N-terminal domain [102108] (1 species)
    5-methyltetrahydrofolate homocysteine S-methyltransferase
  7. 2090088Species Thermotoga maritima [TaxId:2336] [102109] (8 PDB entries)
  8. 2090096Domain d3bolb2: 3bol B:1-300 [155456]
    Other proteins in same PDB: d3bola1, d3bolb1
    automated match to d1q7qa2
    complexed with hcs, k, yt3, zn

Details for d3bolb2

PDB Entry: 3bol (more details), 1.85 Å

PDB Description: Cobalamin-dependent methionine synthase (1-566) from Thermotoga maritima complexed with Zn2+
PDB Compounds: (B:) 5-methyltetrahydrofolate S-homocysteine methyltransferase

SCOPe Domain Sequences for d3bolb2:

Sequence, based on SEQRES records: (download)

>d3bolb2 c.1.26.1 (B:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri

Sequence, based on observed residues (ATOM records): (download)

>d3bolb2 c.1.26.1 (B:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagyplk
phdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri

SCOPe Domain Coordinates for d3bolb2:

Click to download the PDB-style file with coordinates for d3bolb2.
(The format of our PDB-style files is described here.)

Timeline for d3bolb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bolb1