![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.154: CdCA1 repeat-like [159778] (1 superfamily) contains two parallel beta-strands of four strands each; the sheets contact each other with edges at a right angle |
![]() | Superfamily c.154.1: CdCA1 repeat-like [159779] (1 family) ![]() |
![]() | Family c.154.1.1: CdCA1 repeat-like [159780] (1 protein) Pfam PF10563 |
![]() | Protein Cadmium-specific carbonic anhydrase CdCA1 [159781] (1 species) |
![]() | Species Thalassiosira weissflogii [TaxId:67004] [159782] (6 PDB entries) Uniprot Q50EL4 1-196! Uniprot Q50EL4 198-406 |
![]() | Domain d3bohb2: 3boh B:27-222 [155450] Other proteins in same PDB: d3boha2, d3bohb3 automated match to d3boha1 complexed with act, cd |
PDB Entry: 3boh (more details), 1.7 Å
SCOPe Domain Sequences for d3bohb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bohb2 c.154.1.1 (B:27-222) Cadmium-specific carbonic anhydrase CdCA1 {Thalassiosira weissflogii [TaxId: 67004]} gwqaeivtefsllnemvdvdpqgilkcvdgrgsdntqfcgpkmpggiyaiahnrgvttle glkqitkevaskghvpsvhgdhssdmlgcgffklwvtgrfddmgyprpqfdadqgakave naggviemhhgshaekvvyinlvenktlepdeddqrfivdgwaagkfgldvpkfliaaaa tvemlggpkkakivip
Timeline for d3bohb2: