Lineage for d3bohb2 (3boh B:27-222)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923772Fold c.154: CdCA1 repeat-like [159778] (1 superfamily)
    contains two parallel beta-strands of four strands each; the sheets contact each other with edges at a right angle
  4. 2923773Superfamily c.154.1: CdCA1 repeat-like [159779] (1 family) (S)
  5. 2923774Family c.154.1.1: CdCA1 repeat-like [159780] (1 protein)
    Pfam PF10563
  6. 2923775Protein Cadmium-specific carbonic anhydrase CdCA1 [159781] (1 species)
  7. 2923776Species Thalassiosira weissflogii [TaxId:67004] [159782] (6 PDB entries)
    Uniprot Q50EL4 1-196! Uniprot Q50EL4 198-406
  8. 2923781Domain d3bohb2: 3boh B:27-222 [155450]
    Other proteins in same PDB: d3boha2, d3bohb3
    automated match to d3boha1
    complexed with act, cd

Details for d3bohb2

PDB Entry: 3boh (more details), 1.7 Å

PDB Description: Carbonic anhydrase from marine diatom Thalassiosira weissflogii- cadmium bound domain 1 with acetate (CDCA1-R1)
PDB Compounds: (B:) Cadmium-specific carbonic anhydrase

SCOPe Domain Sequences for d3bohb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bohb2 c.154.1.1 (B:27-222) Cadmium-specific carbonic anhydrase CdCA1 {Thalassiosira weissflogii [TaxId: 67004]}
gwqaeivtefsllnemvdvdpqgilkcvdgrgsdntqfcgpkmpggiyaiahnrgvttle
glkqitkevaskghvpsvhgdhssdmlgcgffklwvtgrfddmgyprpqfdadqgakave
naggviemhhgshaekvvyinlvenktlepdeddqrfivdgwaagkfgldvpkfliaaaa
tvemlggpkkakivip

SCOPe Domain Coordinates for d3bohb2:

Click to download the PDB-style file with coordinates for d3bohb2.
(The format of our PDB-style files is described here.)

Timeline for d3bohb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bohb3