Lineage for d1cmyd_ (1cmy D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 276117Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 276166Species Human (Homo sapiens) [TaxId:9606] [46501] (100 PDB entries)
  8. 276365Domain d1cmyd_: 1cmy D: [15545]
    Other proteins in same PDB: d1cmya_, d1cmyc_
    complexed with hem

Details for d1cmyd_

PDB Entry: 1cmy (more details), 3 Å

PDB Description: the mutation beta99 asp-tyr stabilizes y-a new, composite quaternary state of human hemoglobin
PDB Compounds: (D:)

SCOP Domain Sequences for d1cmyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmyd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvypenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1cmyd_:

Click to download the PDB-style file with coordinates for d1cmyd_.
(The format of our PDB-style files is described here.)

Timeline for d1cmyd_: