SCOP 1.63: Domain d1cmyd_: 1cmy D:

Lineage for d1cmyd_ (1cmy D:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (95 PDB entries)

8. Domain d1cmyd_: 1cmy D: [15545]
   Other proteins in same PDB: d1cmya_, d1cmyc_
   complexed with hem

Details for d1cmyd_

PDB Entry: 1cmy, 3 Å

PDB Description: the mutation beta99 asp-tyr stabilizes y-a new, composite quaternary state of human hemoglobin

SCOP Domain Sequences for d1cmyd_:

Sequence; same for both SEQRES and ATOM records:

>d1cmyd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvypenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1cmyd_:

• d1cmyd_ first appeared (with stable ids) in SCOP 1.55
  
• d1cmyd_ appears in SCOP 1.61
  
• d1cmyd_ appears in SCOP 1.65
  
• d1cmyd_ appears in the current release, SCOPe 2.08