Lineage for d1cmyd_ (1cmy D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 329Species Human (Homo sapiens) [TaxId:9606] [46501] (71 PDB entries)
  8. 461Domain d1cmyd_: 1cmy D: [15545]
    Other proteins in same PDB: d1cmya_, d1cmyc_

Details for d1cmyd_

PDB Entry: 1cmy (more details), 3 Å

PDB Description: the mutation beta99 asp-tyr stabilizes y-a new, composite quaternary state of human hemoglobin

SCOP Domain Sequences for d1cmyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmyd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvypenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1cmyd_:

Click to download the PDB-style file with coordinates for d1cmyd_.
(The format of our PDB-style files is described here.)

Timeline for d1cmyd_: