SCOPe 2.06: Domain d3bnfa_: 3bnf A:

Lineage for d3bnfa_ (3bnf A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (11 species)
   not a true protein

7. Species Wolinella succinogenes [TaxId:844] [187217] (4 PDB entries)

8. Domain d3bnfa_: 3bnf A: [155438]
   automated match to d1fs7a_
   complexed with act, ca, hem, so3, y1

Details for d3bnfa_

PDB Entry: 3bnf, 1.7 Å

PDB Description: W. succinogenes NrfA Sulfite Complex

PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d3bnfa_:

Sequence; same for both SEQRES and ATOM records:

>d3bnfa_ a.138.1.3 (A:) automated matches {Wolinella succinogenes [TaxId: 844]}
ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk

Timeline for d3bnfa_:

• d3bnfa_ first appeared in SCOP 1.75, called d3bnfa1
  
• d3bnfa_ appears in SCOPe 2.05
  
• d3bnfa_ appears in SCOPe 2.07
  
• d3bnfa_ appears in the current release, SCOPe 2.08