Lineage for d3bnca1 (3bnc A:150-839)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008080Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 2008081Superfamily a.119.1: Lipoxigenase [48484] (3 families) (S)
  5. 2008082Family a.119.1.1: Plant lipoxigenases [48485] (2 protein domains)
    automatically mapped to Pfam PF00305
  6. 2008083Protein Lipoxigenase, C-terminal domain [48486] (2 species)
    N-terminal domain is beta-sandwich similar to colipase-binding domain of pancreatic lipase
    contains alpha plus beta subdomain: res. 341-495; alpha-beta(5)-alpha
  7. 2008084Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [48487] (22 PDB entries)
  8. 2008092Domain d3bnca1: 3bnc A:150-839 [155432]
    Other proteins in same PDB: d3bnca2
    automated match to d1f8na1
    complexed with acy, fe; mutant

Details for d3bnca1

PDB Entry: 3bnc (more details), 1.65 Å

PDB Description: Lipoxygenase-1 (Soybean) I553G Mutant
PDB Compounds: (A:) seed lipoxygenase-1

SCOPe Domain Sequences for d3bnca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bnca1 a.119.1.1 (A:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
vpsetpaplveyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggs
stfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpa
fesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpq
phvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsld
ldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaie
lslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamep
fviathrhlsvlhpiyklltphyrnnmninalarqslinangigettflpskysvemssa
vyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyv
plyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasal
haavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlisls
vieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnr
lgpvqlpytllypsseegltfrgipnsisi

SCOPe Domain Coordinates for d3bnca1:

Click to download the PDB-style file with coordinates for d3bnca1.
(The format of our PDB-style files is described here.)

Timeline for d3bnca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bnca2