SCOPe 2.02: Domain d3bn9f1: 3bn9 F:1-113

Lineage for d3bn9f1 (3bn9 F:1-113)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158863] (1 PDB entry)

8. Domain d3bn9f1: 3bn9 F:1-113 [155428]
   Other proteins in same PDB: d3bn9a_, d3bn9b_, d3bn9d2, d3bn9f2
   automatically matched to d1qd0a_
   complexed with edo, so4

Details for d3bn9f1

PDB Entry: 3bn9, 2.17 Å

PDB Description: crystal structure of mt-sp1 in complex with fab inhibitor e2

PDB Compounds: (F:) E2 Fab Heavy Chain

SCOPe Domain Sequences for d3bn9f1:

Sequence; same for both SEQRES and ATOM records:

>d3bn9f1 b.1.1.1 (F:1-113) Camelid IG heavy chain variable domain, VHh {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsggglvkpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
adsvkgrftisrdnskntlylqmsslraedtavyycarpyltypqrrgpqnvspfdnwgq
gtmvtvss

Timeline for d3bn9f1:

• d3bn9f1 first appeared in SCOP 1.75
  
• d3bn9f1 appears in SCOPe 2.01
  
• d3bn9f1 appears in SCOPe 2.03
  
• d3bn9f1 appears in the current release, SCOPe 2.08