Lineage for d3bn9f1 (3bn9 F:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739533Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 2739568Species Human (Homo sapiens) [TaxId:9606] [158863] (2 PDB entries)
  8. 2739570Domain d3bn9f1: 3bn9 F:1-113 [155428]
    Other proteins in same PDB: d3bn9a_, d3bn9b_, d3bn9c1, d3bn9c2, d3bn9d2, d3bn9e1, d3bn9e2, d3bn9f2
    automatically matched to d1qd0a_
    complexed with edo, so4

Details for d3bn9f1

PDB Entry: 3bn9 (more details), 2.17 Å

PDB Description: crystal structure of mt-sp1 in complex with fab inhibitor e2
PDB Compounds: (F:) E2 Fab Heavy Chain

SCOPe Domain Sequences for d3bn9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bn9f1 b.1.1.1 (F:1-113) Camelid IG heavy chain variable domain, VHh {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsggglvkpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
adsvkgrftisrdnskntlylqmsslraedtavyycarpyltypqrrgpqnvspfdnwgq
gtmvtvss

SCOPe Domain Coordinates for d3bn9f1:

Click to download the PDB-style file with coordinates for d3bn9f1.
(The format of our PDB-style files is described here.)

Timeline for d3bn9f1: