SCOPe 2.08: Domain d3bn9d1: 3bn9 D:1-113

Lineage for d3bn9d1 (3bn9 D:1-113)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [158863] (2 PDB entries)
Domain d3bn9d1: 3bn9 D:1-113 [155426]
Other proteins in same PDB: d3bn9a_, d3bn9b_, d3bn9c1, d3bn9c2, d3bn9d2, d3bn9e1, d3bn9e2, d3bn9f2
automatically matched to d1qd0a_
complexed with edo, so4

Details for d3bn9d1

PDB Entry: 3bn9 (more details), 2.17 Å

PDB Description: crystal structure of mt-sp1 in complex with fab inhibitor e2

PDB Compounds: (D:) E2 Fab Heavy Chain

SCOPe Domain Sequences for d3bn9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bn9d1 b.1.1.1 (D:1-113) Camelid IG heavy chain variable domain, VHh {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsggglvkpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
adsvkgrftisrdnskntlylqmsslraedtavyycarpyltypqrrgpqnvspfdnwgq
gtmvtvss

SCOPe Domain Coordinates for d3bn9d1:

Click to download the PDB-style file with coordinates for d3bn9d1.
(The format of our PDB-style files is described here.)

Timeline for d3bn9d1: