Lineage for d3bn0a1 (3bn0 A:2-102)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942074Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 2942075Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 2942076Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 2942077Protein Ribosomal protein S16 [54567] (3 species)
  7. 2942078Species Aquifex aeolicus [TaxId:63363] [160142] (1 PDB entry)
    Uniprot O66523 2-102
  8. 2942079Domain d3bn0a1: 3bn0 A:2-102 [155425]
    complexed with gol

Details for d3bn0a1

PDB Entry: 3bn0 (more details), 2 Å

PDB Description: The ribosomal protein S16 from Aquifex aeolicus
PDB Compounds: (A:) 30S ribosomal protein S16

SCOPe Domain Sequences for d3bn0a1:

Sequence, based on SEQRES records: (download)

>d3bn0a1 d.27.1.1 (A:2-102) Ribosomal protein S16 {Aquifex aeolicus [TaxId: 63363]}
avrirlakfgrkhhpiyrivvmdakspregkyidilgtydpkrkvlinvypekvkewvlk
gvelshrakailwnhgilkevvpegyemkrvgdyyvfekre

Sequence, based on observed residues (ATOM records): (download)

>d3bn0a1 d.27.1.1 (A:2-102) Ribosomal protein S16 {Aquifex aeolicus [TaxId: 63363]}
avrirlakfgrkhhpiyrivvmdakyidilgtydpkrkvlinvypekvkewvlkgvelsh
rakailwnhgilkevvpegyemkrvgdyyvfekre

SCOPe Domain Coordinates for d3bn0a1:

Click to download the PDB-style file with coordinates for d3bn0a1.
(The format of our PDB-style files is described here.)

Timeline for d3bn0a1: