Lineage for d3bmva4 (3bmv A:1-406)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815286Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 815510Protein Cyclodextrin glycosyltransferase [51452] (6 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 815577Species Thermoanaerobacterium [TaxId:28895] [159380] (2 PDB entries)
  8. 815578Domain d3bmva4: 3bmv A:1-406 [155419]
    Other proteins in same PDB: d3bmva1, d3bmva2, d3bmva3
    automatically matched to d1a47a4
    complexed with ca, gol, so4; mutant

Details for d3bmva4

PDB Entry: 3bmv (more details), 1.6 Å

PDB Description: Cyclodextrin glycosyl transferase from Thermoanerobacterium thermosulfurigenes EM1 mutant S77P
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOP Domain Sequences for d3bmva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]}
asdtavsnvvnystdviyqivtdrfvdgntsnnptgdlydpthtslkkyfggdwqgiink
indgyltgmgvtaiwipqpveniyavlpdstfggstsyhgywardfkrtnpyfgsftdfq
nlintahahnikviidfapnhtspasetdptyaengrlydngtllggytndtngyfhhyg
gtdfssyedgiyrnlfdladlnqqnstidsylksaikvwldmgidgirldavkhmpfgwq
knfmdsilsyrpvftfgewflgtneidvnntyfanesgmslldfrfsqkvrqvfrdntdt
mygldsmiqstasdynfindmvtfidnhdmdrfynggstrpveqalaftltsrgvpaiyy
gteqymtgngdpynrammtsfntsttaynvikklaplrksnpaiay

SCOP Domain Coordinates for d3bmva4:

Click to download the PDB-style file with coordinates for d3bmva4.
(The format of our PDB-style files is described here.)

Timeline for d3bmva4: