SCOPe 2.05: Domain d3bm9a_: 3bm9 A:

Lineage for d3bm9a_ (3bm9 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein HSP90 [55876] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55878] (80 PDB entries)
   Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223

8. Domain d3bm9a_: 3bm9 A: [155415]
   automated match to d1osfa_
   complexed with bxz

Details for d3bm9a_

PDB Entry: 3bm9, 1.6 Å

PDB Description: Discovery of Benzisoxazoles as Potent Inhibitors of Chaperone Hsp90

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3bm9a_:

Sequence; same for both SEQRES and ATOM records:

>d3bm9a_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfve

Timeline for d3bm9a_:

• d3bm9a_ first appeared in SCOP 1.75, called d3bm9a1
  
• d3bm9a_ appears in SCOPe 2.04
  
• d3bm9a_ appears in SCOPe 2.06
  
• d3bm9a_ appears in the current release, SCOPe 2.08