Lineage for d3blze_ (3blz E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405614Family d.17.4.14: Sbal0622-like [159985] (1 protein)
    PfamB PB002762
    automatically mapped to Pfam PF12893
  6. 1405615Protein Uncharacterized protein Sbal0622 [159986] (1 species)
  7. 1405616Species Shewanella baltica [TaxId:62322] [159987] (1 PDB entry)
    Uniprot A3D088 3-126
  8. 1405621Domain d3blze_: 3blz E: [155407]
    automated match to d3blza1
    complexed with edo, peg

Details for d3blze_

PDB Entry: 3blz (more details), 1.75 Å

PDB Description: crystal structure of a ntf2-like protein of unknown function (sbal_0622) from shewanella baltica os155 at 1.75 a resolution
PDB Compounds: (E:) NTF2-like protein of unknown function

SCOPe Domain Sequences for d3blze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3blze_ d.17.4.14 (E:) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]}
nttyvqeyhaivevlskyneggkkadstimrpafssqatifgvdvdnkltggpiqglfdv
idnvfhpspeakaaiaridivgtaasaridtddisgfrftdffnllkvegkwtvvskiyh
thps

SCOPe Domain Coordinates for d3blze_:

Click to download the PDB-style file with coordinates for d3blze_.
(The format of our PDB-style files is described here.)

Timeline for d3blze_: