![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.14: Sbal0622-like [159985] (1 protein) PfamB PB002762 automatically mapped to Pfam PF12893 |
![]() | Protein Uncharacterized protein Sbal0622 [159986] (1 species) |
![]() | Species Shewanella baltica [TaxId:62322] [159987] (1 PDB entry) Uniprot A3D088 3-126 |
![]() | Domain d3blzc_: 3blz C: [155405] automated match to d3blza1 complexed with edo, peg |
PDB Entry: 3blz (more details), 1.75 Å
SCOPe Domain Sequences for d3blzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3blzc_ d.17.4.14 (C:) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} nttyvqeyhaivevlskyneggkkadstimrpafssqatifgvdvdnkltggpiqglfdv idnvfhpspeakaaiaridivgtaasaridtddisgfrftdffnllkvegkwtvvskiyh thps
Timeline for d3blzc_: