SCOP 1.75: Domain d3blrb2: 3blr B:9-150

Lineage for d3blrb2 (3blr B:9-150)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin T1 [158595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158596] (4 PDB entries)
   Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150

8. Domain d3blrb2: 3blr B:9-150 [155401]
   Other proteins in same PDB: d3blra1
   automatically matched to 3BLH B:5-150
   complexed with cpb, po4; mutant

Details for d3blrb2

PDB Entry: 3blr, 2.8 Å

PDB Description: crystal structure of human cdk9/cyclint1 in complex with flavopiridol

PDB Compounds: (B:) Cyclin-T1

SCOP Domain Sequences for d3blrb2:

Sequence; same for both SEQRES and ATOM records:

>d3blrb2 a.74.1.1 (B:9-150) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
nkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymhr
fymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrseaylq
qvqdlvilesiilqtlgfelti

Timeline for d3blrb2:

• d3blrb2 is new in SCOP 1.75
  
• d3blrb2 appears in SCOPe 2.01
  
• d3blrb2 appears in the current release, SCOPe 2.08