Lineage for d3blra1 (3blr A:8-325)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874549Protein Cell division protein kinase 9, CDK9 [160810] (1 species)
  7. 874550Species Human (Homo sapiens) [TaxId:9606] [160811] (3 PDB entries)
    Uniprot P50750 8-325
  8. 874552Domain d3blra1: 3blr A:8-325 [155399]
    Other proteins in same PDB: d3blrb1, d3blrb2
    automatically matched to 3BLH A:8-325
    complexed with cpb, po4; mutant

Details for d3blra1

PDB Entry: 3blr (more details), 2.8 Å

PDB Description: crystal structure of human cdk9/cyclint1 in complex with flavopiridol
PDB Compounds: (A:) Cell division protein kinase 9

SCOP Domain Sequences for d3blra1:

Sequence, based on SEQRES records: (download)

>d3blra1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik
rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn
rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs
itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd
dalnhdffwsdpmpsdlk

Sequence, based on observed residues (ATOM records): (download)

>d3blra1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtsiylvfdfcehdlagllsnvlvkftlseikrvmqmllngl
yyihrnkilhrdmkaanvlitrdgvlkladfglarafslapnrytnrvvtlwyrppelll
gerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdnyel
yeklelvkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdpmpsdlk

SCOP Domain Coordinates for d3blra1:

Click to download the PDB-style file with coordinates for d3blra1.
(The format of our PDB-style files is described here.)

Timeline for d3blra1: