SCOPe 2.05: Domain d3blqb2: 3blq B:9-150

Lineage for d3blqb2 (3blq B:9-150)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin T1 [158595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
   Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150

8. Domain d3blqb2: 3blq B:9-150 [155398]
   Other proteins in same PDB: d3blqa_
   automated match to d3blhb2
   complexed with atp, mg, trs

Details for d3blqb2

PDB Entry: 3blq, 2.9 Å

PDB Description: crystal structure of human cdk9/cyclint1 in complex with atp

PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d3blqb2:

Sequence; same for both SEQRES and ATOM records:

>d3blqb2 a.74.1.1 (B:9-150) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
nkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymhr
fymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrseaylq
qvqdlvilesiilqtlgfelti

Timeline for d3blqb2:

• d3blqb2 first appeared in SCOP 1.75
  
• d3blqb2 appears in SCOPe 2.04
  
• d3blqb2 appears in SCOPe 2.06
  
• d3blqb2 appears in the current release, SCOPe 2.08