Lineage for d3blqb1 (3blq B:151-259)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739685Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1739686Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1739687Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1740045Protein Cyclin T1 [158595] (1 species)
  7. 1740046Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
    Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150
  8. 1740055Domain d3blqb1: 3blq B:151-259 [155397]
    Other proteins in same PDB: d3blqa_
    automated match to d3blhb1
    complexed with atp, mg, trs

Details for d3blqb1

PDB Entry: 3blq (more details), 2.9 Å

PDB Description: crystal structure of human cdk9/cyclint1 in complex with atp
PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d3blqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3blqb1 a.74.1.1 (B:151-259) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr

SCOPe Domain Coordinates for d3blqb1:

Click to download the PDB-style file with coordinates for d3blqb1.
(The format of our PDB-style files is described here.)

Timeline for d3blqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3blqb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3blqa_