Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries) |
Domain d3blqa_: 3blq A: [155396] Other proteins in same PDB: d3blqb1, d3blqb2 automated match to d1h4la_ complexed with atp, mg, trs |
PDB Entry: 3blq (more details), 2.9 Å
SCOPe Domain Sequences for d3blqa_:
Sequence, based on SEQRES records: (download)
>d3blqa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalre ikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlsei krvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnryt nrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcg sitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqrids ddalnhdffwsdpmpsdlk
>d3blqa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalre ikilqllkhenvvnlieicrtsiylvfdfcehdlagllsnvlvkftlseikrvmqmllng lyyihrnkilhrdmkaanvlitrdgvlkladfglarafsnrytnrvvtlwyrppelllge rdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdnyelye klelvvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdpmpsdlk
Timeline for d3blqa_: