| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin T1 [158595] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries) Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150 |
| Domain d3blhb1: 3blh B:151-259 [155394] Other proteins in same PDB: d3blha1 complexed with trs |
PDB Entry: 3blh (more details), 2.48 Å
SCOPe Domain Sequences for d3blhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3blhb1 a.74.1.1 (B:151-259) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr
Timeline for d3blhb1: