Lineage for d3blha1 (3blh A:8-325)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1929741Protein Cell division protein kinase 9, CDK9 [160810] (1 species)
  7. 1929742Species Human (Homo sapiens) [TaxId:9606] [160811] (6 PDB entries)
    Uniprot P50750 8-325
  8. 1929744Domain d3blha1: 3blh A:8-325 [155393]
    Other proteins in same PDB: d3blhb1, d3blhb2
    complexed with trs

Details for d3blha1

PDB Entry: 3blh (more details), 2.48 Å

PDB Description: Crystal Structure of Human CDK9/cyclinT1
PDB Compounds: (A:) Cell division protein kinase 9

SCOPe Domain Sequences for d3blha1:

Sequence, based on SEQRES records: (download)

>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik
rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn
rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs
itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd
dalnhdffwsdpmpsdlk

Sequence, based on observed residues (ATOM records): (download)

>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvekegfpitalreikilq
llkhenvvnlieicrtsiylvfdfcehdlagllsnvlvkftlseikrvmqmllnglyyih
rnkilhrdmkaanvlitrdgvlkladfglarafslpnrytnrvvtlwyrppelllgerdy
gppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdnylvkgqkr
kvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdpmpsdlk

SCOPe Domain Coordinates for d3blha1:

Click to download the PDB-style file with coordinates for d3blha1.
(The format of our PDB-style files is described here.)

Timeline for d3blha1: