Lineage for d3blab1 (3bla B:146-336)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891450Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 1891451Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 1891589Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins)
  6. 1891590Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (2 species)
  7. 1891591Species Human (Homo sapiens) [TaxId:9606] [102747] (5 PDB entries)
  8. 1891601Domain d3blab1: 3bla B:146-336 [155388]
    Other proteins in same PDB: d3blaa2, d3blab2
    automated match to d1st0a1
    protein/RNA complex; complexed with dd3

Details for d3blab1

PDB Entry: 3bla (more details), 2.6 Å

PDB Description: Synthetic Gene Encoded DcpS bound to inhibitor DG153249
PDB Compounds: (B:) Scavenger mRNA-decapping enzyme DcpS

SCOPe Domain Sequences for d3blab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3blab1 d.13.1.3 (B:146-336) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqq

SCOPe Domain Coordinates for d3blab1:

Click to download the PDB-style file with coordinates for d3blab1.
(The format of our PDB-style files is described here.)

Timeline for d3blab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3blab2