Lineage for d3blaa2 (3bla A:42-145)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614505Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily)
    beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a
  4. 2614506Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) (S)
    forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4]
    automatically mapped to Pfam PF05652
  5. 2614507Family d.246.1.1: mRNA decapping enzyme DcpS N-terminal domain [102861] (1 protein)
  6. 2614508Protein mRNA decapping enzyme DcpS N-terminal domain [102862] (2 species)
  7. 2614509Species Human (Homo sapiens) [TaxId:9606] [102863] (5 PDB entries)
  8. 2614518Domain d3blaa2: 3bla A:42-145 [155387]
    Other proteins in same PDB: d3blaa1, d3blab1
    automated match to d1st0a2
    protein/RNA complex; complexed with dd3

Details for d3blaa2

PDB Entry: 3bla (more details), 2.6 Å

PDB Description: Synthetic Gene Encoded DcpS bound to inhibitor DG153249
PDB Compounds: (A:) Scavenger mRNA-decapping enzyme DcpS

SCOPe Domain Sequences for d3blaa2:

Sequence, based on SEQRES records: (download)

>d3blaa2 d.246.1.1 (A:42-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqlltgs
pelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr

Sequence, based on observed residues (ATOM records): (download)

>d3blaa2 d.246.1.1 (A:42-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lpfsgfrlqkvlresardkiiflhgkvneedavvilektpfqveqvaqlltgspelqlqf
sndiystyhlfpprqlndvkttvvypatekhlqkylr

SCOPe Domain Coordinates for d3blaa2:

Click to download the PDB-style file with coordinates for d3blaa2.
(The format of our PDB-style files is described here.)

Timeline for d3blaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3blaa1