Lineage for d3blaa1 (3bla A:146-334)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852844Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 852845Superfamily d.13.1: HIT-like [54197] (4 families) (S)
  5. 852948Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (1 protein)
  6. 852949Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (2 species)
  7. 852950Species Human (Homo sapiens) [TaxId:9606] [102747] (7 PDB entries)
  8. 852965Domain d3blaa1: 3bla A:146-334 [155386]
    Other proteins in same PDB: d3blaa2, d3blab2
    automatically matched to d1st0a1
    complexed with dd3

Details for d3blaa1

PDB Entry: 3bla (more details), 2.6 Å

PDB Description: Synthetic Gene Encoded DcpS bound to inhibitor DG153249
PDB Compounds: (A:) Scavenger mRNA-decapping enzyme DcpS

SCOP Domain Sequences for d3blaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3blaa1 d.13.1.3 (A:146-334) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqea

SCOP Domain Coordinates for d3blaa1:

Click to download the PDB-style file with coordinates for d3blaa1.
(The format of our PDB-style files is described here.)

Timeline for d3blaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3blaa2