Lineage for d3bl9b2 (3bl9 B:40-145)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214592Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily)
    beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a
  4. 2214593Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) (S)
    forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4]
    automatically mapped to Pfam PF05652
  5. 2214594Family d.246.1.1: mRNA decapping enzyme DcpS N-terminal domain [102861] (1 protein)
  6. 2214595Protein mRNA decapping enzyme DcpS N-terminal domain [102862] (2 species)
  7. 2214596Species Human (Homo sapiens) [TaxId:9606] [102863] (5 PDB entries)
  8. 2214598Domain d3bl9b2: 3bl9 B:40-145 [155385]
    Other proteins in same PDB: d3bl9a1, d3bl9b1
    automated match to d1st0a2
    protein/RNA complex; complexed with dd2

Details for d3bl9b2

PDB Entry: 3bl9 (more details), 1.8 Å

PDB Description: synthetic gene encoded dcps bound to inhibitor dg157493
PDB Compounds: (B:) Scavenger mRNA-decapping enzyme DcpS

SCOPe Domain Sequences for d3bl9b2:

Sequence, based on SEQRES records: (download)

>d3bl9b2 d.246.1.1 (B:40-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqllt
gspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr

Sequence, based on observed residues (ATOM records): (download)

>d3bl9b2 d.246.1.1 (B:40-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vrlpfsgfrlqkvlresardkiiflhgkvnedavvilektpfqveqvaqlltgspelqlq
fsndiystyhlfpprqlndvkttvvypatekhlqkylr

SCOPe Domain Coordinates for d3bl9b2:

Click to download the PDB-style file with coordinates for d3bl9b2.
(The format of our PDB-style files is described here.)

Timeline for d3bl9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bl9b1