SCOPe 2.08: Domain d3bl9b2: 3bl9 B:40-145

Lineage for d3bl9b2 (3bl9 B:40-145)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily)
   beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a

4. Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families)
   forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4]
   automatically mapped to Pfam PF05652

5. Family d.246.1.1: mRNA decapping enzyme DcpS N-terminal domain [102861] (1 protein)

6. Protein mRNA decapping enzyme DcpS N-terminal domain [102862] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102863] (5 PDB entries)

8. Domain d3bl9b2: 3bl9 B:40-145 [155385]
   Other proteins in same PDB: d3bl9a1, d3bl9b1
   automated match to d1st0a2
   protein/RNA complex; complexed with dd2

Details for d3bl9b2

PDB Entry: 3bl9, 1.8 Å

PDB Description: synthetic gene encoded dcps bound to inhibitor dg157493

PDB Compounds: (B:) Scavenger mRNA-decapping enzyme DcpS

SCOPe Domain Sequences for d3bl9b2:

Sequence, based on SEQRES records:

>d3bl9b2 d.246.1.1 (B:40-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqllt
gspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr

Sequence, based on observed residues (ATOM records):

>d3bl9b2 d.246.1.1 (B:40-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vrlpfsgfrlqkvlresardkiiflhgkvnedavvilektpfqveqvaqlltgspelqlq
fsndiystyhlfpprqlndvkttvvypatekhlqkylr

Timeline for d3bl9b2:

• d3bl9b2 first appeared in SCOP 1.75
  
• d3bl9b2 appears in SCOPe 2.07