Lineage for d3bl9a1 (3bl9 A:146-334)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929951Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins)
  6. 2929952Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (2 species)
  7. 2929953Species Human (Homo sapiens) [TaxId:9606] [102747] (5 PDB entries)
  8. 2929958Domain d3bl9a1: 3bl9 A:146-334 [155382]
    Other proteins in same PDB: d3bl9a2, d3bl9b2
    automated match to d1st0a1
    protein/RNA complex; complexed with dd2

Details for d3bl9a1

PDB Entry: 3bl9 (more details), 1.8 Å

PDB Description: synthetic gene encoded dcps bound to inhibitor dg157493
PDB Compounds: (A:) Scavenger mRNA-decapping enzyme DcpS

SCOPe Domain Sequences for d3bl9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bl9a1 d.13.1.3 (A:146-334) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqea

SCOPe Domain Coordinates for d3bl9a1:

Click to download the PDB-style file with coordinates for d3bl9a1.
(The format of our PDB-style files is described here.)

Timeline for d3bl9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bl9a2