SCOPe 2.08: Domain d3bl7b1: 3bl7 B:146-336

Lineage for d3bl7b1 (3bl7 B:146-336)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins)

6. Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102747] (5 PDB entries)

8. Domain d3bl7b1: 3bl7 B:146-336 [155380]
   Other proteins in same PDB: d3bl7a2, d3bl7b2
   automated match to d1st0a1
   protein/RNA complex; complexed with dd1

Details for d3bl7b1

PDB Entry: 3bl7, 2.31 Å

PDB Description: Synthetic Gene Encoded DcpS bound to inhibitor DG156844

PDB Compounds: (B:) Scavenger mRNA-decapping enzyme DcpS

SCOPe Domain Sequences for d3bl7b1:

Sequence; same for both SEQRES and ATOM records:

>d3bl7b1 d.13.1.3 (B:146-336) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqq

Timeline for d3bl7b1:

• d3bl7b1 first appeared in SCOP 1.75
  
• d3bl7b1 appears in SCOPe 2.07