Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins) |
Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102747] (5 PDB entries) |
Domain d3bl7b1: 3bl7 B:146-336 [155380] Other proteins in same PDB: d3bl7a2, d3bl7b2 automated match to d1st0a1 protein/RNA complex; complexed with dd1 |
PDB Entry: 3bl7 (more details), 2.31 Å
SCOPe Domain Sequences for d3bl7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bl7b1 d.13.1.3 (B:146-336) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd pllkllqeaqq
Timeline for d3bl7b1: