SCOP 1.75: Domain d3bl2b1: 3bl2 B:6-134

Lineage for d3bl2b1 (3bl2 B:6-134)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
   Pfam PF00452

6. Protein Bcl-2 homolog V-bcl-2 [144081] (1 species)

7. Species Murid herpesvirus 4 [TaxId:33708] [144082] (3 PDB entries)
   Uniprot P89884 6-136

8. Domain d3bl2b1: 3bl2 B:6-134 [155377]
   automatically matched to d2aboa1

Details for d3bl2b1

PDB Entry: 3bl2, 2.3 Å

PDB Description: crystal structure of m11, the bcl-2 homolog of murine gamma- herpesvirus 68, complexed with mouse beclin1 (residues 106-124)

PDB Compounds: (B:) V-bcl-2

SCOP Domain Sequences for d3bl2b1:

Sequence; same for both SEQRES and ATOM records:

>d3bl2b1 f.1.4.1 (B:6-134) Bcl-2 homolog V-bcl-2 {Murid herpesvirus 4 [TaxId: 33708]}
sgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyradygpalk
nwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcmthffie
nnlmnhfpl

Timeline for d3bl2b1:

• d3bl2b1 is new in SCOP 1.75
  
• d3bl2b1 is called d3bl2b_ in SCOPe 2.01
  
• d3bl2b1 appears in the current release, SCOPe 2.08, called d3bl2b_