SCOPe 2.08: Domain d3bl2a_: 3bl2 A:

Lineage for d3bl2a_ (3bl2 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Bcl-2 homolog V-bcl-2 [144081] (1 species)

7. Species Murid herpesvirus 4 [TaxId:33708] [144082] (3 PDB entries)
   Uniprot P89884 6-136

8. Domain d3bl2a_: 3bl2 A: [155376]
   automated match to d2aboa1

Details for d3bl2a_

PDB Entry: 3bl2, 2.3 Å

PDB Description: crystal structure of m11, the bcl-2 homolog of murine gamma- herpesvirus 68, complexed with mouse beclin1 (residues 106-124)

PDB Compounds: (A:) V-bcl-2

SCOPe Domain Sequences for d3bl2a_:

Sequence; same for both SEQRES and ATOM records:

>d3bl2a_ f.1.4.1 (A:) Bcl-2 homolog V-bcl-2 {Murid herpesvirus 4 [TaxId: 33708]}
ksgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyradygpal
knwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcmthffi
ennlmnhfple

Timeline for d3bl2a_:

• d3bl2a_ first appeared in SCOP 1.75, called d3bl2a1
  
• d3bl2a_ appears in SCOPe 2.07