Lineage for d3bkua_ (3bku A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2176307Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2176351Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 protein domains)
    automatically mapped to Pfam PF08753
  6. 2176352Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 2176353Species Escherichia coli [TaxId:562] [103001] (8 PDB entries)
  8. 2176369Domain d3bkua_: 3bku A: [155368]
    automated match to d1q5ya_

Details for d3bkua_

PDB Entry: 3bku (more details), 2.1 Å

PDB Description: apo c-terminal domain of nikr
PDB Compounds: (A:) Nickel-responsive regulator

SCOPe Domain Sequences for d3bkua_:

Sequence, based on SEQRES records: (download)

>d3bkua_ d.58.18.4 (A:) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
qgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvqh
faddviaqrgvrhghlqclpk

Sequence, based on observed residues (ATOM records): (download)

>d3bkua_ d.58.18.4 (A:) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
qgfavlsyvyehekrhdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrh
ghlqclpk

SCOPe Domain Coordinates for d3bkua_:

Click to download the PDB-style file with coordinates for d3bkua_.
(The format of our PDB-style files is described here.)

Timeline for d3bkua_: