Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) contains a single copy of this fold and an extra beta-strand at the C-terminus |
Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins) Pfam PF00408 |
Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries) |
Domain d3bkqx4: 3bkq X:368-463 [155363] Other proteins in same PDB: d3bkqx1, d3bkqx2, d3bkqx3 automated match to d1p5dx4 complexed with g1p, zn; mutant |
PDB Entry: 3bkq (more details), 2.05 Å
SCOPe Domain Sequences for d3bkqx4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bkqx4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} gsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp vlvlrfeadteeeleriktvfrnqlkavdsslpvpf
Timeline for d3bkqx4: