Lineage for d3bkqx4 (3bkq X:368-463)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2581959Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2581960Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 2581984Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species)
  7. 2581985Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries)
  8. 2581994Domain d3bkqx4: 3bkq X:368-463 [155363]
    Other proteins in same PDB: d3bkqx1, d3bkqx2, d3bkqx3
    automated match to d1p5dx4
    complexed with g1p, zn; mutant

Details for d3bkqx4

PDB Entry: 3bkq (more details), 2.05 Å

PDB Description: structure of the p368g mutant of pmm/pgm in complex with its substrate
PDB Compounds: (X:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d3bkqx4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bkqx4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
gsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOPe Domain Coordinates for d3bkqx4:

Click to download the PDB-style file with coordinates for d3bkqx4.
(The format of our PDB-style files is described here.)

Timeline for d3bkqx4: