SCOPe 2.08: Domain d3bkqx1: 3bkq X:6-154

Lineage for d3bkqx1 (3bkq X:6-154)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
   consists of three similar domains with 3 layers (a/b/a) each; duplication
   core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families)

5. Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)

6. Protein Phosphomannomutase/phosphoglucomutase, N-terminal domain [419008] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [419480] (12 PDB entries)

8. Domain d3bkqx1: 3bkq X:6-154 [155360]
   Other proteins in same PDB: d3bkqx2, d3bkqx3, d3bkqx4
   automated match to d1k2yx1
   complexed with g1p, zn; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d3bkqx1

PDB Entry: 3bkq, 2.05 Å

PDB Description: structure of the p368g mutant of pmm/pgm in complex with its substrate

PDB Compounds: (X:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d3bkqx1:

Sequence; same for both SEQRES and ATOM records:

>d3bkqx1 c.84.1.1 (X:6-154) Phosphomannomutase/phosphoglucomutase, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelv
kqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvaget
laneqiqalreriekndlasgvgsveqvd

Timeline for d3bkqx1:

• d3bkqx1 first appeared in SCOP 1.75
  
• d3bkqx1 appears in SCOPe 2.07