SCOPe 2.08: Domain d3bkmh_: 3bkm H:

Lineage for d3bkmh_ (3bkm H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d3bkmh_: 3bkm H: [155359]
   Other proteins in same PDB: d3bkml1, d3bkml2
   automated match to d6shgh_
   complexed with na, zn

Details for d3bkmh_

PDB Entry: 3bkm, 1.6 Å

PDB Description: Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)

PDB Compounds: (H:) WO2 IgG2a Fab fragment Heavy Chain

SCOPe Domain Sequences for d3bkmh_:

Sequence; same for both SEQRES and ATOM records:

>d3bkmh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vtlkesgpgllkpsqtlsltcsfsgfsirtskvgvswirqpsgkglewlahiywdddkry
npslesrltiskdtsrdmvfmkitsvdtadtatyycarrgfygrkyevnhfdywgqgttl
tvssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpav
lqsdlytlsssvtvtsstwpsesitcnvahpasstkvdkkivpr

Timeline for d3bkmh_:

• d3bkmh_ first appeared in SCOP 1.75, called d3bkmh1
  
• d3bkmh_ was called d3bkmh1 in SCOPe 2.07