Lineage for d3bkib_ (3bki B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879268Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 1879277Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)
  8. 1879392Domain d3bkib_: 3bki B: [155354]
    automated match to d1lbcb_
    protein/RNA complex; complexed with fqx

Details for d3bkib_

PDB Entry: 3bki (more details), 1.87 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with fqx at 1.87 angstroms
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d3bkib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bkib_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar
dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks
kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneq
glldklknkwwydkgec

SCOPe Domain Coordinates for d3bkib_:

Click to download the PDB-style file with coordinates for d3bkib_.
(The format of our PDB-style files is described here.)

Timeline for d3bkib_: