Lineage for d3bkfa1 (3bkf A:49-131)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2176307Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2176351Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 protein domains)
    automatically mapped to Pfam PF08753
  6. 2176352Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 2176353Species Escherichia coli [TaxId:562] [103001] (8 PDB entries)
  8. 2176362Domain d3bkfa1: 3bkf A:49-131 [155353]
    automatically matched to d1q5vb2
    complexed with zn

Details for d3bkfa1

PDB Entry: 3bkf (more details), 1.9 Å

PDB Description: zinc-bound c-terminal domain of nikr
PDB Compounds: (A:) Nickel-responsive regulator

SCOPe Domain Sequences for d3bkfa1:

Sequence, based on SEQRES records: (download)

>d3bkfa1 d.58.18.4 (A:49-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv
qhfaddviaqrgvrhghlqclpk

Sequence, based on observed residues (ATOM records): (download)

>d3bkfa1 d.58.18.4 (A:49-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrhgh
lqclpk

SCOPe Domain Coordinates for d3bkfa1:

Click to download the PDB-style file with coordinates for d3bkfa1.
(The format of our PDB-style files is described here.)

Timeline for d3bkfa1: