Lineage for d3bjzd_ (3bjz D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908254Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
    dimer of mono-domain subunits
  6. 2908270Protein Phosphoheptose isomerase GmhA1 [110723] (4 species)
  7. 2908279Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [159784] (1 PDB entry)
  8. 2908283Domain d3bjzd_: 3bjz D: [155341]
    Other proteins in same PDB: d3bjzb3
    automated match to d1x92b_
    complexed with cl, so4

Details for d3bjzd_

PDB Entry: 3bjz (more details), 2.4 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa phosphoheptose isomerase
PDB Compounds: (D:) Phosphoheptose isomerase

SCOPe Domain Sequences for d3bjzd_:

Sequence, based on SEQRES records: (download)

>d3bjzd_ c.80.1.3 (D:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
dmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqhf
ssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllaists
gnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhllai
hclcdlidrqlfgs

Sequence, based on observed residues (ATOM records): (download)

>d3bjzd_ c.80.1.3 (D:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
dmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqhf
ssellnrrpslpavalttnevfskqiralgqpgdvllaistsgnsanviqaiqaahdrem
lvvaltgrdgggmaslllpedveirvpskitariqevhllaihclcdlidrqlfgs

SCOPe Domain Coordinates for d3bjzd_:

Click to download the PDB-style file with coordinates for d3bjzd_.
(The format of our PDB-style files is described here.)

Timeline for d3bjzd_: