Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.3: mono-SIS domain [69599] (6 proteins) dimer of mono-domain subunits |
Protein Phosphoheptose isomerase GmhA1 [110723] (4 species) |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [159784] (1 PDB entry) |
Domain d3bjzc_: 3bjz C: [155340] Other proteins in same PDB: d3bjzb3 automated match to d1x92b_ complexed with cl, so4 |
PDB Entry: 3bjz (more details), 2.4 Å
SCOPe Domain Sequences for d3bjzc_:
Sequence, based on SEQRES records: (download)
>d3bjzc_ c.80.1.3 (C:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} mdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqh fssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllaist sgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhlla ihclcdlidrqlfgs
>d3bjzc_ c.80.1.3 (C:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} mdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqh fssellnrerpslpavalttynevfskqiralgqpgdvllaistsgnsanviqaiqaahd remlvvaltgrdgggmaslllpedveirvpskitariqevhllaihclcdlidrqlfgs
Timeline for d3bjzc_:
View in 3D Domains from other chains: (mouse over for more information) d3bjza_, d3bjzb2, d3bjzb3, d3bjzd_ |