Lineage for d1glib_ (1gli B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 329Species Human (Homo sapiens) [TaxId:9606] [46501] (71 PDB entries)
  8. 448Domain d1glib_: 1gli B: [15534]
    Other proteins in same PDB: d1glia_, d1glic_

Details for d1glib_

PDB Entry: 1gli (more details), 2.5 Å

PDB Description: deoxyhemoglobin t38w (alpha chains), v1g (alpha and beta chains)

SCOP Domain Sequences for d1glib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glib_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1glib_:

Click to download the PDB-style file with coordinates for d1glib_.
(The format of our PDB-style files is described here.)

Timeline for d1glib_: