Lineage for d3bjzb2 (3bjz B:1-195)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140400Family c.80.1.3: mono-SIS domain [69599] (6 protein domains)
    dimer of mono-domain subunits
  6. 2140416Protein Phosphoheptose isomerase GmhA1 [110723] (4 species)
  7. 2140425Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [159784] (1 PDB entry)
  8. 2140427Domain d3bjzb2: 3bjz B:1-195 [155339]
    Other proteins in same PDB: d3bjzb3
    automated match to d1x92b_
    complexed with cl, so4

Details for d3bjzb2

PDB Entry: 3bjz (more details), 2.4 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa phosphoheptose isomerase
PDB Compounds: (B:) Phosphoheptose isomerase

SCOPe Domain Sequences for d3bjzb2:

Sequence, based on SEQRES records: (download)

>d3bjzb2 c.80.1.3 (B:1-195) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqh
fssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllaist
sgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhlla
ihclcdlidrqlfgs

Sequence, based on observed residues (ATOM records): (download)

>d3bjzb2 c.80.1.3 (B:1-195) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqh
fssellnrfererpslpavalttdssynevfskqiralgqpgdvllaistsgnsanviqa
iqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhllaihclcdlidr
qlfgs

SCOPe Domain Coordinates for d3bjzb2:

Click to download the PDB-style file with coordinates for d3bjzb2.
(The format of our PDB-style files is described here.)

Timeline for d3bjzb2: