Lineage for d3bjmb2 (3bjm B:509-766)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1870521Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 1870528Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 1870529Species Human (Homo sapiens) [TaxId:9606] [82499] (54 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 1870629Domain d3bjmb2: 3bjm B:509-766 [155335]
    Other proteins in same PDB: d3bjma1, d3bjmb1
    automated match to d1nu6a2
    complexed with bjm, nag

Details for d3bjmb2

PDB Entry: 3bjm (more details), 2.35 Å

PDB Description: crystal structure of human dpp-iv in complex with (1s,3s, 5s)-2-[(2s)- 2-amino-2-(3-hydroxytricyclo[3.3.1.13,7]dec-1- yl)acetyl]-2- azabicyclo[3.1.0]hexane-3-carbonitrile (cas), (1s,3s,5s)-2-((2s)-2- amino-2-(3-hydroxyadamantan-1- yl)acetyl)-2-azabicyclo[3.1.0]hexane- 3-carbonitrile (iupac), or bms-477118
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3bjmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjmb2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d3bjmb2:

Click to download the PDB-style file with coordinates for d3bjmb2.
(The format of our PDB-style files is described here.)

Timeline for d3bjmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bjmb1