Lineage for d3bj3d1 (3bj3 D:1-146)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759496Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (4 PDB entries)
    Uniprot P83273; 86% sequence identity
  8. 759502Domain d3bj3d1: 3bj3 D:1-146 [155328]
    automatically matched to d1xq5b_
    complexed with ace, hem

Details for d3bj3d1

PDB Entry: 3bj3 (more details), 2.1 Å

PDB Description: met-Perch hemoglobin at pH 8.0
PDB Compounds: (D:) hemoglobin beta

SCOP Domain Sequences for d3bj3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bj3d1 a.1.1.2 (D:1-146) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
afsgevqaafqkflsvvvsalgkqyh

SCOP Domain Coordinates for d3bj3d1:

Click to download the PDB-style file with coordinates for d3bj3d1.
(The format of our PDB-style files is described here.)

Timeline for d3bj3d1: