Lineage for d3bj3b_ (3bj3 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716690Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1717296Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (4 PDB entries)
    Uniprot P83273; 86% sequence identity
  8. 1717301Domain d3bj3b_: 3bj3 B: [155327]
    Other proteins in same PDB: d3bj3a_, d3bj3c_
    automated match to d1xq5b_
    complexed with ace, hem

Details for d3bj3b_

PDB Entry: 3bj3 (more details), 2.1 Å

PDB Description: met-Perch hemoglobin at pH 8.0
PDB Compounds: (B:) hemoglobin beta

SCOPe Domain Sequences for d3bj3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bj3b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
afsgevqaafqkflsvvvsalgkqyh

SCOPe Domain Coordinates for d3bj3b_:

Click to download the PDB-style file with coordinates for d3bj3b_.
(The format of our PDB-style files is described here.)

Timeline for d3bj3b_: