Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (25 species) |
Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (4 PDB entries) Uniprot P83273; 86% sequence identity |
Domain d3bj3b_: 3bj3 B: [155327] Other proteins in same PDB: d3bj3a_, d3bj3c_ automated match to d1xq5b_ complexed with ace, hem |
PDB Entry: 3bj3 (more details), 2.1 Å
SCOPe Domain Sequences for d3bj3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bj3b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]} vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk afsgevqaafqkflsvvvsalgkqyh
Timeline for d3bj3b_: