SCOPe 2.01: Domain d3bj2d_: 3bj2 D:

Lineage for d3bj2d_ (3bj2 D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (4 PDB entries)
   Uniprot P83273; 86% sequence identity

8. Domain d3bj2d_: 3bj2 D: [155326]
   Other proteins in same PDB: d3bj2a_, d3bj2c_
   automated match to d1xq5b_
   complexed with ace, hem

Details for d3bj2d_

PDB Entry: 3bj2, 2 Å

PDB Description: met-Perch Hemoglobin at pH 6.3

PDB Compounds: (D:) hemoglobin beta

SCOPe Domain Sequences for d3bj2d_:

Sequence; same for both SEQRES and ATOM records:

>d3bj2d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
afsgevqaafqkflsvvvsalgkqyh

Timeline for d3bj2d_:

• d3bj2d_ first appeared in SCOP 1.75, called d3bj2d1
  
• d3bj2d_ appears in SCOPe 2.02
  
• d3bj2d_ appears in the current release, SCOPe 2.08