SCOPe 2.05: Domain d3bj1b_: 3bj1 B:

Lineage for d3bj1b_ (3bj1 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (4 PDB entries)
   Uniprot P83273; 86% sequence identity

8. Domain d3bj1b_: 3bj1 B: [155323]
   Other proteins in same PDB: d3bj1a_, d3bj1c_
   automated match to d1xq5b_
   complexed with ace, hem

Details for d3bj1b_

PDB Entry: 3bj1, 1.9 Å

PDB Description: met-Perch Hemoglobin at pH 5.7

PDB Compounds: (B:) hemoglobin beta

SCOPe Domain Sequences for d3bj1b_:

Sequence, based on SEQRES records:

>d3bj1b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
afsgevqaafqkflsvvvsalgkqyh

Sequence, based on observed residues (ATOM records):

>d3bj1b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlnaaaimgnpmia
khgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgka
fsgevqaafqkflsvvvsalgkqyh

Timeline for d3bj1b_:

• d3bj1b_ first appeared in SCOP 1.75, called d3bj1b1
  
• d3bj1b_ appears in SCOPe 2.04
  
• d3bj1b_ appears in SCOPe 2.06
  
• d3bj1b_ appears in the current release, SCOPe 2.08