Lineage for d3bj1b_ (3bj1 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2301046Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (4 PDB entries)
    Uniprot P83273; 86% sequence identity
  8. 2301047Domain d3bj1b_: 3bj1 B: [155323]
    Other proteins in same PDB: d3bj1a_, d3bj1c_
    automated match to d1xq5b_
    complexed with ace, hem

Details for d3bj1b_

PDB Entry: 3bj1 (more details), 1.9 Å

PDB Description: met-Perch Hemoglobin at pH 5.7
PDB Compounds: (B:) hemoglobin beta

SCOPe Domain Sequences for d3bj1b_:

Sequence, based on SEQRES records: (download)

>d3bj1b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
afsgevqaafqkflsvvvsalgkqyh

Sequence, based on observed residues (ATOM records): (download)

>d3bj1b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlnaaaimgnpmia
khgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgka
fsgevqaafqkflsvvvsalgkqyh

SCOPe Domain Coordinates for d3bj1b_:

Click to download the PDB-style file with coordinates for d3bj1b_.
(The format of our PDB-style files is described here.)

Timeline for d3bj1b_: