Lineage for d3biwe1 (3biw E:82-288)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794771Family b.29.1.4: Laminin G-like module [49944] (6 proteins)
  6. 794797Protein Ligand-binding domain of neurexin 1beta [49949] (2 species)
  7. 794801Species Rat (Rattus norvegicus) [TaxId:10116] [49950] (4 PDB entries)
  8. 794819Domain d3biwe1: 3biw E:82-288 [155319]
    automatically matched to d1c4rg_
    complexed with ca, nag

Details for d3biwe1

PDB Entry: 3biw (more details), 3.5 Å

PDB Description: crystal structure of the neuroligin-1/neurexin-1beta synaptic adhesion complex
PDB Compounds: (E:) Neurexin-1-beta

SCOP Domain Sequences for d3biwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3biwe1 b.29.1.4 (E:82-288) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]}
hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv

SCOP Domain Coordinates for d3biwe1:

Click to download the PDB-style file with coordinates for d3biwe1.
(The format of our PDB-style files is described here.)

Timeline for d3biwe1: