Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (2 families) |
Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) |
Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102923] (4 PDB entries) |
Domain d3bimg1: 3bim G:7-128 [155317] automatically matched to d1r2ba_ mutant |
PDB Entry: 3bim (more details), 2.6 Å
SCOP Domain Sequences for d3bimg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bimg1 d.42.1.1 (G:7-128) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik as
Timeline for d3bimg1: